By tool

One-shot examples, roughly one per tool, showing what each tool is for on its own. The agent picks the tools itself from their descriptions; seeing the mapping helps you understand what the server can do.

Identify an unknown domain from a keyword

Prompt: “I keep seeing ‘kringle domain’ in papers. What is it, and what InterPro entry describes it?”

Tools: searchInterProgetEntry

Free-text search has no accession to start from, so the agent searches for kringle domain, finds candidate entries, then pulls full metadata (definition, GO terms, member signatures, literature) for the best hit, InterPro IPR000001.

Look up a signature and place it on the tree of life

Prompt: “What is Pfam PF00069, and is it mostly a eukaryotic or a bacterial domain?”

Tools: getEntrygetTaxonomicDistribution

getEntry resolves PF00069 to the protein-kinase domain (integrated into IPR000719). getTaxonomicDistribution with depth: 1 returns the superkingdom breakdown: the domain is overwhelmingly eukaryotic, without downloading the large full species-level tree.

Annotate a UniProt protein

Prompt: “What domains are in UniProt P99999, and where are they?”

Tools: getProteinEntries

One call fetches the sequence, computes its MD5, and returns every matching member-database signature and integrated InterPro entry with residue locations.

Go from a function (GO term) to the domains that carry it

Prompt: “Which InterPro entries are annotated with the protein-kinase activity term GO:0004672?”

Tools: searchByGoTerm

Returns the InterPro entries associated with that molecular-function term, paginated.

Find example proteins for a domain, filtered to a species

Prompt: “List some reviewed human proteins that contain the kringle domain IPR000001.”

Tools: getEntryProteins

With reviewedOnly: true and taxId: "9606", the agent gets Swiss-Prot human proteins carrying the domain (plasminogen, prothrombin, HGF, etc.), each with the matched residue ranges and an AlphaFold-model flag.

Find structural representatives of a domain

Prompt: “What PDB structures contain the protein-kinase domain PF00069?”

Tools: getEntryStructures

Returns the PDB entries that include the domain: PDB id, title, experiment type, resolution, and where in each structure the domain maps.

Understand the context a domain appears in

Prompt: “What domain architectures does the Tubby domain IPR000007 occur in?”

Tools: getDomainArchitectures

Returns the recurring ordered domain combinations the entry is part of across UniProt, each with a representative protein and how many proteins share that architecture.

Analyse a brand-new sequence

Prompt: “Run InterProScan on this sequence and tell me what domains it has: MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE

Tools: analyzeSequencegetSequenceAnalysis

Because the sequence may not be in InterPro’s precomputed set, the agent runs a live InterProScan 6 job on the EMBL-EBI Job Dispatcher. analyzeSequence submits and waits a bounded time; if the job finishes it returns the full result, otherwise a jobId the agent retrieves a moment later with getSequenceAnalysis. The verdict here: a cytochrome c domain (Pfam PF00034, InterPro IPR009056 / IPR036909).

Screen a batch of sequences

Prompt: “Here are 20 protein sequences. Which already have precomputed InterPro matches?”

Tools: matchSequences

Looks up all of them in one call (up to 100), keyed by MD5, reporting for each whether it was found and its matches.